PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G22840.1
Common NameAtGRF1, GRF1, T20K9.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRF
Protein Properties Length: 530aa    MW: 56401.3 Da    PI: 9.6778
Description growth-regulating factor 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G22840.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.37.6e-25196240145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  AT2G22840.1 196 DPEPGRCRRTDGKKWRCSRDAVPDQKYCERHINRGRHRSRKPVEG 240
                  79****************************************985 PP

2QLQ51.53.1e-18132168137
          QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                  ++F+ +Q+++L++Q+l+yKy+ an+PvP+ Ll+ ++k
  AT2G22840.1 132 GPFSLTQWAELEQQALIYKYITANVPVPSSLLLSLKK 168
                  59******************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.3E-10132168IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.723133168IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.2E-12133165IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.954196240IPR014977WRC domain
PfamPF088793.4E-21197239IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0005515Molecular Functionprotein binding
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0006203anatomypericycle
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0020144anatomyapical meristem
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MDLGVRVSGH ETVSSPGQTE LGSGFSNKQE RSGFDGEDCW RSSKLSRTST DGFSSSPASA  60
KTLSFHQGIP LLRSTTINDP RKGQEHMLSF SSASGKSDVS PYLQYCRNSG YGLGGMMNTS  120
NMHGNLLTGV KGPFSLTQWA ELEQQALIYK YITANVPVPS SLLLSLKKSF FPYGSLPPNS  180
FGWGSFHLGF SGGNMDPEPG RCRRTDGKKW RCSRDAVPDQ KYCERHINRG RHRSRKPVEG  240
QNGHNTNAAA AASAAAASTA AAVSKAAAGT SAVAMRGSDN NNSLAAAVGT QHHTNNQSTD  300
SLANRVQNSR GASVFPATMN LQSKETHPKQ SNNPFEFGLI SSDSLLNPSH KQASYATSSK  360
GFGSYLDFGN QAKHAGNHNN VDSWPEELKS DWTQLSMSIP MAPSSPVQDK LALSPLRLSR  420
EFDPAIHMGL GVNTEFLDPG KKTNNWIPIS WGNNNSMGGP LGEVLNSTTN SPKFGSSPTG  480
VLQKSTFGSL SNSSSASSTI IGDNNNKNGD GKDPLGPTTL MNTSATAPSL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.281440.0bud| flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible266797_at0.0
Expression AtlasAT2G22840-
AtGenExpressAT2G22840-
ATTED-IIAT2G22840-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during the early stages of leaf development and expression decreases with the maturation of the leaf. {ECO:0000269|PubMed:20023165}.
UniprotTISSUE SPECIFICITY: Strongly expressed in actively growing and developing tissues, such as roots, upper stems, and shoot tips containing the shoot apical meristem (SAM) and flower buds. Also expressed in mature flowers, but weakly expressed in mature stems and leaves. {ECO:0000269|PubMed:12974814}.
Functional Description ? help Back to Top
Source Description
TAIRGrowth regulating factor encoding transcription activator. One of the nine members of a GRF gene family, containing nuclear targeting domain. Mutants result in smaller leaves indicating the role of the gene in leaf development. Expressed in root, shoot and flower
UniProtTranscription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. microRNA396-GRF1/GRF3 regulatory module acts as a developmental regulator in the reprogramming of root cells during cyst nematode infection, leading to the formation of the syncytium. {ECO:0000269|PubMed:12974814, ECO:0000269|PubMed:15326298, ECO:0000269|PubMed:22419826, ECO:0000269|PubMed:22751317}.
Function -- GeneRIF ? help Back to Top
  1. GRF1 and GRF3 are posttranscriptionally regulated by miR396 during nematode infection.
    [PMID: 22419826]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G22840.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). Up-regulated in response to cyst nematode infection. {ECO:0000269|PubMed:15200956, ECO:0000269|PubMed:19453503, ECO:0000269|PubMed:20023165, ECO:0000269|PubMed:22419826}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch O81001
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G22840
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1026340.0AY102634.1 Arabidopsis thaliana transcription activator (GRF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_179869.10.0growth-regulating factor 1
SwissprotO810010.0GRF1_ARATH; Growth-regulating factor 1
TrEMBLD7LE480.0D7LE48_ARALL; Putative uncharacterized protein
STRINGAT2G22840.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14542886
Representative plantOGRP33571226
Publications ? help Back to Top
  1. Kim JH,Choi D,Kende H
    The AtGRF family of putative transcription factors is involved in leaf and cotyledon growth in Arabidopsis.
    Plant J., 2003. 36(1): p. 94-104
    [PMID:12974814]
  2. Leonhardt N, et al.
    Microarray expression analyses of Arabidopsis guard cells and isolation of a recessive abscisic acid hypersensitive protein phosphatase 2C mutant.
    Plant Cell, 2004. 16(3): p. 596-615
    [PMID:14973164]
  3. Jones-Rhoades MW,Bartel DP
    Computational identification of plant microRNAs and their targets, including a stress-induced miRNA.
    Mol. Cell, 2004. 14(6): p. 787-99
    [PMID:15200956]
  4. Kim JH,Kende H
    A transcriptional coactivator, AtGIF1, is involved in regulating leaf growth and morphology in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(36): p. 13374-9
    [PMID:15326298]
  5. Lobbes D,Rallapalli G,Schmidt DD,Martin C,Clarke J
    SERRATE: a new player on the plant microRNA scene.
    EMBO Rep., 2006. 7(10): p. 1052-8
    [PMID:16977334]
  6. Liu D,Song Y,Chen Z,Yu D
    Ectopic expression of miR396 suppresses GRF target gene expression and alters leaf growth in Arabidopsis.
    Physiol Plant, 2009. 136(2): p. 223-36
    [PMID:19453503]
  7. Rodriguez RE, et al.
    Control of cell proliferation in Arabidopsis thaliana by microRNA miR396.
    Development, 2010. 137(1): p. 103-12
    [PMID:20023165]
  8. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]
  9. Hewezi T,Maier TR,Nettleton D,Baum TJ
    The Arabidopsis microRNA396-GRF1/GRF3 regulatory module acts as a developmental regulator in the reprogramming of root cells during cyst nematode infection.
    Plant Physiol., 2012. 159(1): p. 321-35
    [PMID:22419826]
  10. Hewezi T,Baum TJ
    Complex feedback regulations govern the expression of miRNA396 and its GRF target genes.
    Plant Signal Behav, 2012. 7(7): p. 749-51
    [PMID:22751317]
  11. Liang G,He H,Li Y,Wang F,Yu D
    Molecular mechanism of microRNA396 mediating pistil development in Arabidopsis.
    Plant Physiol., 2014. 164(1): p. 249-58
    [PMID:24285851]